PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma338g00040.1
Common NameZOSMA_338G00040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 603aa    MW: 66906.9 Da    PI: 6.8225
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma338g00040.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.94e-093513881954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Zosma338g00040.1 351 FEHflHPYPKDSDKHILAKQTGLTRNQVSNWFINARVR 388
                       554459******************************88 PP

2BELL115.62.4e-37212283172
              BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       erqelq kkakL+++ +e +krY+qy++q+q+vissFe++ag+g+ak Yt+lAlk+iS++FrcL+da+++qi
  Zosma338g00040.1 212 ERQELQTKKAKLINMFDEAEKRYRQYYNQMQVVISSFEVIAGVGTAKTYTALALKTISKQFRCLRDALSGQI 283
                       79********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.5E-57143281IPR006563POX domain
PfamPF075263.3E-45148279IPR006563POX domain
PROSITE profilePS5007112.001329392IPR001356Homeobox domain
CDDcd000862.31E-11332393No hitNo description
SMARTSM003896.0E-8332396IPR001356Homeobox domain
SuperFamilySSF466891.75E-16333399IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-28335398IPR009057Homeodomain-like
PfamPF059201.8E-17349388IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MATYYHGGAE IQSDELQTLC LMNPGCVGYP PPDDAGVGDS PTTSNMMFFN SGALGHHQHL  60
MGIPLHQNQS VVSVQDMASY NLWNPSPMTN NSVGLTSHLG IRQKGLSLSL LPEQKQINYG  120
INQQHHLRFS GSESEVEPAN GISGMQRVLL GSKYLKAAQQ LLDDVVSVGK GVVKKESQNT  180
AAKSTKEMLE CEESNAGETS GKRAAVELSM TERQELQTKK AKLINMFDEA EKRYRQYYNQ  240
MQVVISSFEV IAGVGTAKTY TALALKTISK QFRCLRDALS GQIRATSKNL GEEDCQIGSK  300
SGEGLTRLRF VDHHLRQQRA LQQLGTMQHN AWRPQRGLPE RSVSVLRAWL FEHFLHPYPK  360
DSDKHILAKQ TGLTRNQVSN WFINARVRLW KPMVEEMYLE ETKAKEADRK CGGEAEADVI  420
PTSTVVYAEE EDGGEENKEE KIHKKPRIRD SSSLLIDPMS TLEMELKPLD TTTTSTNSNS  480
HDALFMRFGE SGGPYSIGDF ARFGNDGHSQ FTPAQQPHHH HQQQQQHFSG NGVTLTLGLQ  540
HCDGLSLSGP PPATYLSSTN DSNHSNIPMG RRLQGLGNVT HDAREYNNSE YETLLSNQLL  600
GQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A5e-16338395158Homeobox protein Meis1
4xrs_B5e-16338395158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008784118.11e-158PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_008784117.11e-158PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_008784116.11e-158PREDICTED: BEL1-like homeodomain protein 1
TrEMBLA0A0K9P8020.0A0A0K9P802_Z
STRINGVIT_06s0009g00410.t011e-146(Vitis vinifera)
STRINGGSMUA_Achr6P18180_0011e-147(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48163758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.34e-91BEL1-like homeodomain 1